PREX1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18344
- Bilder (1)
| Artikelname: | PREX1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18344 |
| Hersteller Artikelnummer: | A18344 |
| Alternativnummer: | ABB-A18344-100UL,ABB-A18344-20UL,ABB-A18344-500UL,ABB-A18344-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | P-REX1, PREX1 |
| The protein encoded by this gene acts as a guanine nucleotide exchange factor for the RHO family of small GTP-binding proteins (RACs). It has been shown to bind to and activate RAC1 by exchanging bound GDP for free GTP. The encoded protein, which is found mainly in the cytoplasm, is activated by phosphatidylinositol-3,4,5-trisphosphate and the beta-gamma subunits of heterotrimeric G proteins. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 186kDa |
| NCBI: | 57580 |
| UniProt: | Q8TCU6 |
| Reinheit: | Affinity purification |
| Sequenz: | PSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMN |
| Target-Kategorie: | PREX1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from T-47D cells using PREX1 Rabbit pAb (A18344) at 1:3700 dilution incubated overnight at 4C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020) Exposure time: 60 s. |
Produktgarantie und fachkundiger Support
