PREX1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18344
- Images (1)
| Article Name: | PREX1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18344 |
| Supplier Catalog Number: | A18344 |
| Alternative Catalog Number: | ABB-A18344-100UL,ABB-A18344-20UL,ABB-A18344-500UL,ABB-A18344-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | P-REX1, PREX1 |
| The protein encoded by this gene acts as a guanine nucleotide exchange factor for the RHO family of small GTP-binding proteins (RACs). It has been shown to bind to and activate RAC1 by exchanging bound GDP for free GTP. The encoded protein, which is found mainly in the cytoplasm, is activated by phosphatidylinositol-3,4,5-trisphosphate and the beta-gamma subunits of heterotrimeric G proteins. |
| Clonality: | Polyclonal |
| Molecular Weight: | 186kDa |
| NCBI: | 57580 |
| UniProt: | Q8TCU6 |
| Purity: | Affinity purification |
| Sequence: | PSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMN |
| Target: | PREX1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from T-47D cells using PREX1 Rabbit pAb (A18344) at 1:3700 dilution incubated overnight at 4C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020) Exposure time: 60 s. |
Product Guarantee and Expert Support
