TLE4 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18345
Artikelname: TLE4 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18345
Hersteller Artikelnummer: A18345
Alternativnummer: ABB-A18345-20UL,ABB-A18345-100UL,ABB-A18345-1000UL,ABB-A18345-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: ESG, BCE1, ESG4, GRG4, BCE-1, Grg-4, E(spI), E(spl), TLE4
Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway, cellular response to leukemia inhibitory factor, and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 7091
UniProt: Q04727
Reinheit: Affinity purification
Sequenz: SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY
Target-Kategorie: TLE4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using TLE4 Rabbit pAb (A18345) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.