TLE4 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18345
Article Name: TLE4 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18345
Supplier Catalog Number: A18345
Alternative Catalog Number: ABB-A18345-20UL,ABB-A18345-100UL,ABB-A18345-1000UL,ABB-A18345-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: ESG, BCE1, ESG4, GRG4, BCE-1, Grg-4, E(spI), E(spl), TLE4
Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway, cellular response to leukemia inhibitory factor, and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 7091
UniProt: Q04727
Purity: Affinity purification
Sequence: SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY
Target: TLE4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using TLE4 Rabbit pAb (A18345) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.