PRAF2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18421
Artikelname: PRAF2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18421
Hersteller Artikelnummer: A18421
Alternativnummer: ABB-A18421-20UL,ABB-A18421-100UL,ABB-A18421-500UL,ABB-A18421-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: JM4, Yip6a, PRAF2
Predicted to be involved in L-glutamate transmembrane transport. Predicted to be located in endosome membrane. Predicted to be integral component of membrane. Predicted to be active in membrane.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 11230
UniProt: O60831
Reinheit: Affinity purification
Sequenz: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLL
Target-Kategorie: PRAF2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using PRAF2 Rabbit pAb (A18421) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.