PRAF2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18421
Article Name: PRAF2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18421
Supplier Catalog Number: A18421
Alternative Catalog Number: ABB-A18421-20UL,ABB-A18421-100UL,ABB-A18421-500UL,ABB-A18421-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: JM4, Yip6a, PRAF2
Predicted to be involved in L-glutamate transmembrane transport. Predicted to be located in endosome membrane. Predicted to be integral component of membrane. Predicted to be active in membrane.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 11230
UniProt: O60831
Purity: Affinity purification
Sequence: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLL
Target: PRAF2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using PRAF2 Rabbit pAb (A18421) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.