NUP205 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18427
Artikelname: NUP205 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18427
Hersteller Artikelnummer: A18427
Alternativnummer: ABB-A18427-20UL,ABB-A18427-100UL,ABB-A18427-1000UL,ABB-A18427-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: NPHS13, C7orf14, NUP205
This gene encodes a nucleoporin, which is a subunit of the nuclear pore complex that functions in active transport of proteins, RNAs and ribonucleoprotein particles between the nucleus and cytoplasm. Mutations in this gene are associated with steroid-resistant nephrotic syndrome.
Klonalität: Polyclonal
Molekulargewicht: 228kDa
NCBI: 23165
UniProt: Q92621
Reinheit: Affinity purification
Sequenz: AASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
Target-Kategorie: NUP205
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using NUP205 Rabbit pAb (A18427) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.