NUP205 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18427
Article Name: NUP205 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18427
Supplier Catalog Number: A18427
Alternative Catalog Number: ABB-A18427-20UL,ABB-A18427-100UL,ABB-A18427-1000UL,ABB-A18427-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: NPHS13, C7orf14, NUP205
This gene encodes a nucleoporin, which is a subunit of the nuclear pore complex that functions in active transport of proteins, RNAs and ribonucleoprotein particles between the nucleus and cytoplasm. Mutations in this gene are associated with steroid-resistant nephrotic syndrome.
Clonality: Polyclonal
Molecular Weight: 228kDa
NCBI: 23165
UniProt: Q92621
Purity: Affinity purification
Sequence: AASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
Target: NUP205
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using NUP205 Rabbit pAb (A18427) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.