UTP11L Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18455
- Bilder (1)
| Artikelname: | UTP11L Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18455 |
| Hersteller Artikelnummer: | A18455 |
| Alternativnummer: | ABB-A18455-100UL,ABB-A18455-20UL,ABB-A18455-500UL,ABB-A18455-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | CGI94, CGI-94, UTP11L |
| Enables RNA binding activity. Involved in nervous system development and positive regulation of apoptotic process. Located in cytoplasm, extracellular space, and nucleolus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 30kDa |
| NCBI: | 51118 |
| UniProt: | Q9Y3A2 |
| Reinheit: | Affinity purification |
| Sequenz: | VAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVKGVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN |
| Target-Kategorie: | UTP11 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using UTP11L Rabbit pAb (A18455) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
