UTP11L Rabbit pAb, Polyclonal

Catalog Number: ABB-A18455
Article Name: UTP11L Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18455
Supplier Catalog Number: A18455
Alternative Catalog Number: ABB-A18455-100UL,ABB-A18455-20UL,ABB-A18455-500UL,ABB-A18455-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: CGI94, CGI-94, UTP11L
Enables RNA binding activity. Involved in nervous system development and positive regulation of apoptotic process. Located in cytoplasm, extracellular space, and nucleolus.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 51118
UniProt: Q9Y3A2
Purity: Affinity purification
Sequence: VAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVKGVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN
Target: UTP11
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using UTP11L Rabbit pAb (A18455) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.