SLTM Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18493
Artikelname: SLTM Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18493
Hersteller Artikelnummer: A18493
Alternativnummer: ABB-A18493-20UL,ABB-A18493-100UL,ABB-A18493-500UL,ABB-A18493-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: Met, SLTM
Enables RNA binding activity. Predicted to be involved in regulation of mRNA processing and regulation of transcription by RNA polymerase II. Located in nuclear body.
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 79811
UniProt: Q9NWH9
Reinheit: Affinity purification
Sequenz: RPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSN
Target-Kategorie: SLTM
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using SLTM Rabbit pAb (A18493) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.