SLTM Rabbit pAb, Polyclonal

Catalog Number: ABB-A18493
Article Name: SLTM Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18493
Supplier Catalog Number: A18493
Alternative Catalog Number: ABB-A18493-20UL,ABB-A18493-100UL,ABB-A18493-500UL,ABB-A18493-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: Met, SLTM
Enables RNA binding activity. Predicted to be involved in regulation of mRNA processing and regulation of transcription by RNA polymerase II. Located in nuclear body.
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 79811
UniProt: Q9NWH9
Purity: Affinity purification
Sequence: RPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSN
Target: SLTM
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using SLTM Rabbit pAb (A18493) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.