ABTB1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18499
- Bilder (1)
| Artikelname: | ABTB1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18499 |
| Hersteller Artikelnummer: | A18499 |
| Alternativnummer: | ABB-A18499-20UL,ABB-A18499-100UL,ABB-A18499-500UL,ABB-A18499-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | BPOZ, BTB3, BTBD21, EF1ABP, PP2259, ABTB1 |
| This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 54kDa |
| NCBI: | 80325 |
| UniProt: | Q969K4 |
| Reinheit: | Affinity purification |
| Sequenz: | MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF |
| Target-Kategorie: | ABTB1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ABTB1 Rabbit pAb (A18499) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
