ABTB1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18499
Article Name: ABTB1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18499
Supplier Catalog Number: A18499
Alternative Catalog Number: ABB-A18499-20UL,ABB-A18499-100UL,ABB-A18499-500UL,ABB-A18499-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: BPOZ, BTB3, BTBD21, EF1ABP, PP2259, ABTB1
This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 80325
UniProt: Q969K4
Purity: Affinity purification
Sequence: MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF
Target: ABTB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors. Shipping: Ice Bag
Western blot analysis of various lysates using ABTB1 Rabbit pAb (A18499) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.