Topors Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18526
Artikelname: Topors Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18526
Hersteller Artikelnummer: A18526
Alternativnummer: ABB-A18526-100UL,ABB-A18526-20UL,ABB-A18526-500UL,ABB-A18526-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: LUN, TP53BPL, p53BP3/LUN, Topors
Predicted to enable several functions, including DNA topoisomerase binding activity, antigen binding activity, and ubiquitin-like protein transferase activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator, positive regulation of transcription, DNA-templated, and regulation of cell population proliferation. Located in ciliary basal body, nucleus, and photoreceptor connecting cilium. Is expressed in skin. Human ortholog(s) of this gene implicated in retinitis pigmentosa 31. Orthologous to human TOPORS (TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase).
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 106021
UniProt: Q80Z37
Reinheit: Affinity purification
Sequenz: PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
Target-Kategorie: Topors
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using Topors Rabbit pAb (A18526) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.