Topors Rabbit pAb, Polyclonal

Catalog Number: ABB-A18526
Article Name: Topors Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18526
Supplier Catalog Number: A18526
Alternative Catalog Number: ABB-A18526-100UL,ABB-A18526-20UL,ABB-A18526-500UL,ABB-A18526-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: LUN, TP53BPL, p53BP3/LUN, Topors
Predicted to enable several functions, including DNA topoisomerase binding activity, antigen binding activity, and ubiquitin-like protein transferase activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator, positive regulation of transcription, DNA-templated, and regulation of cell population proliferation. Located in ciliary basal body, nucleus, and photoreceptor connecting cilium. Is expressed in skin. Human ortholog(s) of this gene implicated in retinitis pigmentosa 31. Orthologous to human TOPORS (TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase).
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 106021
UniProt: Q80Z37
Purity: Affinity purification
Sequence: PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
Target: Topors
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using Topors Rabbit pAb (A18526) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.