SEC62 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18589
- Bilder (1)
| Artikelname: | SEC62 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18589 |
| Hersteller Artikelnummer: | A18589 |
| Alternativnummer: | ABB-A18589-100UL,ABB-A18589-20UL,ABB-A18589-500UL,ABB-A18589-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | HTP1, TP-1, Dtrp1, TLOC1, SEC62 |
| The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 46kDa |
| NCBI: | 7095 |
| UniProt: | Q99442 |
| Reinheit: | Affinity purification |
| Sequenz: | GRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS |
| Target-Kategorie: | SEC62 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SEC62 Rabbit pAb (A18589) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:45s. |
Produktgarantie und fachkundiger Support
