SEC62 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18589
- Images (1)
| Article Name: | SEC62 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18589 |
| Supplier Catalog Number: | A18589 |
| Alternative Catalog Number: | ABB-A18589-100UL,ABB-A18589-20UL,ABB-A18589-500UL,ABB-A18589-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | HTP1, TP-1, Dtrp1, TLOC1, SEC62 |
| The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. |
| Clonality: | Polyclonal |
| Molecular Weight: | 46kDa |
| NCBI: | 7095 |
| UniProt: | Q99442 |
| Purity: | Affinity purification |
| Sequence: | GRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS |
| Target: | SEC62 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SEC62 Rabbit pAb (A18589) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:45s. |
Product Guarantee and Expert Support
