CXCL9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1864
Artikelname: CXCL9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1864
Hersteller Artikelnummer: A1864
Alternativnummer: ABB-A1864-100UL,ABB-A1864-20UL,ABB-A1864-1000UL,ABB-A1864-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CMK, MIG, Humig, SCYB9, crg-10, CXCL9
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 4283
UniProt: Q07325
Reinheit: Affinity purification
Sequenz: KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Target-Kategorie: CXCL9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CXCL9 Rabbit pAb (A1864) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.