CXCL9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1864
Article Name: CXCL9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1864
Supplier Catalog Number: A1864
Alternative Catalog Number: ABB-A1864-100UL,ABB-A1864-20UL,ABB-A1864-1000UL,ABB-A1864-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CMK, MIG, Humig, SCYB9, crg-10, CXCL9
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 4283
UniProt: Q07325
Purity: Affinity purification
Sequence: KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Target: CXCL9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CXCL9 Rabbit pAb (A1864) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.