LY96 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1866
- Bilder (1)
| Artikelname: | LY96 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1866 |
| Hersteller Artikelnummer: | A1866 |
| Alternativnummer: | ABB-A1866-20UL,ABB-A1866-100UL,ABB-A1866-500UL,ABB-A1866-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MD2, MD-2, ly-96, ESOP-1, LY96 |
| This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 19kDa |
| NCBI: | 23643 |
| UniProt: | Q9Y6Y9 |
| Reinheit: | Affinity purification |
| Sequenz: | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
| Target-Kategorie: | LY96 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LY96 Rabbit pAb (A1866) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Produktgarantie und fachkundiger Support
