LY96 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1866
- Images (1)
| Article Name: | LY96 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1866 |
| Supplier Catalog Number: | A1866 |
| Alternative Catalog Number: | ABB-A1866-20UL,ABB-A1866-100UL,ABB-A1866-500UL,ABB-A1866-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MD2, MD-2, ly-96, ESOP-1, LY96 |
| This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 19kDa |
| NCBI: | 23643 |
| UniProt: | Q9Y6Y9 |
| Purity: | Affinity purification |
| Sequence: | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
| Target: | LY96 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LY96 Rabbit pAb (A1866) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
