GTF2F1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A19315
- Bilder (1)
| Artikelname: | GTF2F1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A19315 |
| Hersteller Artikelnummer: | A19315 |
| Alternativnummer: | ABB-A19315-100UL,ABB-A19315-20UL,ABB-A19315-1000UL,ABB-A19315-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | BTF4, RAP74, TF2F1, TFIIF, GTF2F1 |
| Enables several functions, including RNA polymerase II general transcription initiation factor activity, phosphatase activator activity, and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of transcription by RNA polymerase II, response to virus, and transcription initiation from RNA polymerase II promoter. Located in cell junction and nucleoplasm. Part of transcription factor TFIID complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 58kDa |
| NCBI: | 2962 |
| UniProt: | P35269 |
| Reinheit: | Affinity purification |
| Sequenz: | PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
| Target-Kategorie: | GTF2F1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase,Serine threonine kinases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GTF2F1 Rabbit pAb (A19315) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
