GTF2F1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A19315
Article Name: GTF2F1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A19315
Supplier Catalog Number: A19315
Alternative Catalog Number: ABB-A19315-100UL,ABB-A19315-20UL,ABB-A19315-1000UL,ABB-A19315-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: BTF4, RAP74, TF2F1, TFIIF, GTF2F1
Enables several functions, including RNA polymerase II general transcription initiation factor activity, phosphatase activator activity, and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of transcription by RNA polymerase II, response to virus, and transcription initiation from RNA polymerase II promoter. Located in cell junction and nucleoplasm. Part of transcription factor TFIID complex.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 2962
UniProt: P35269
Purity: Affinity purification
Sequence: PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Target: GTF2F1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase,Serine threonine kinases. Shipping: Ice Bag
Western blot analysis of various lysates using GTF2F1 Rabbit pAb (A19315) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.