PP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A19333
Artikelname: PP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A19333
Hersteller Artikelnummer: A19333
Alternativnummer: ABB-A19333-100UL,ABB-A19333-20UL,ABB-A19333-1000UL,ABB-A19333-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: B56E, B56epsilon, PP2A-B56delta/PR61delta/PPP2R5E
The protein encoded by this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily. Multiple transcript variants encoding several different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 5529
UniProt: Q16537
Reinheit: Affinity purification
Sequenz: LLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
Target-Kategorie: PPP2R5E
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen usingPP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb (A19333) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.