PP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A19333
Article Name: PP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A19333
Supplier Catalog Number: A19333
Alternative Catalog Number: ABB-A19333-100UL,ABB-A19333-20UL,ABB-A19333-1000UL,ABB-A19333-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: B56E, B56epsilon, PP2A-B56delta/PR61delta/PPP2R5E
The protein encoded by this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily. Multiple transcript variants encoding several different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 5529
UniProt: Q16537
Purity: Affinity purification
Sequence: LLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
Target: PPP2R5E
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen usingPP2A-B56delta/PR61delta/PPP2R5E Rabbit pAb (A19333) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.