Acetyl-Histone H4-K5 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A19525
- Bilder (8)
| Artikelname: | Acetyl-Histone H4-K5 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A19525 |
| Hersteller Artikelnummer: | A19525 |
| Alternativnummer: | ABB-A19525-100UL,ABB-A19525-20UL,ABB-A19525-1000UL,ABB-A19525-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | DOT, ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | H4/p, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST4H4, Acetyl-Histone H4-K5 |
| Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC0002] |
| Molekulargewicht: | 11kDa |
| NCBI: | 8359 |
| UniProt: | P62805 |
| Reinheit: | Affinity purification |
| Sequenz: | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Target-Kategorie: | Histone H4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|DB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics & Nuclear Signaling,Epigenetic Modifications. Shipping: Ice Bag |
|
|
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated with TSA (1 uM) at 37°C for 18 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human appendix using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).C6 cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).NIH-3T3 cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).U-2 OS cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
