Acetyl-Histone H4-K5 Rabbit mAb, Unconjugated

Catalog Number: ABB-A19525
Article Name: Acetyl-Histone H4-K5 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A19525
Supplier Catalog Number: A19525
Alternative Catalog Number: ABB-A19525-100UL,ABB-A19525-20UL,ABB-A19525-1000UL,ABB-A19525-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: DOT, ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H4/p, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST4H4, Acetyl-Histone H4-K5
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element.
Clonality: Monoclonal
Clone Designation: [ARC0002]
Molecular Weight: 11kDa
NCBI: 8359
UniProt: P62805
Purity: Affinity purification
Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Target: Histone H4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|DB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics & Nuclear Signaling,Epigenetic Modifications. Shipping: Ice Bag
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded Rat brain using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated with TSA (1 uM) at 37°C for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human appendix using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).C6 cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).NIH-3T3 cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).U-2 OS cells were treated with TSA (1 uM) at 37°C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.