NDP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1964
Artikelname: NDP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1964
Hersteller Artikelnummer: A1964
Alternativnummer: ABB-A1964-20UL,ABB-A1964-100UL,ABB-A1964-1000UL,ABB-A1964-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ND, EVR2, FEVR, NDP
This gene encodes a secreted protein with a cystein-knot motif that activates the Wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in Norrie disease and X-linked exudative vitreoretinopathy.
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 4693
UniProt: Q00604
Reinheit: Affinity purification
Sequenz: KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Target-Kategorie: NDP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Growth factors,Neuroscience,Neurodegenerative Diseases,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from PC-3 cells, using NDP Rabbit pAb (A1964) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.