NDP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1964
Article Name: NDP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1964
Supplier Catalog Number: A1964
Alternative Catalog Number: ABB-A1964-20UL,ABB-A1964-100UL,ABB-A1964-1000UL,ABB-A1964-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ND, EVR2, FEVR, NDP
This gene encodes a secreted protein with a cystein-knot motif that activates the Wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in Norrie disease and X-linked exudative vitreoretinopathy.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 4693
UniProt: Q00604
Purity: Affinity purification
Sequence: KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Target: NDP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Growth factors,Neuroscience,Neurodegenerative Diseases,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from PC-3 cells, using NDP Rabbit pAb (A1964) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.