SETD1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20155
Artikelname: SETD1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20155
Hersteller Artikelnummer: A20155
Alternativnummer: ABB-A20155-20UL,ABB-A20155-100UL,ABB-A20155-500UL,ABB-A20155-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KMT2G, Set1B, IDDSELD, SETD1B
SET1B is a component of a histone methyltransferase complex that produces trimethylated histone H3 at Lys4 (Lee et al., 2007 [PubMed 17355966]).
Klonalität: Polyclonal
Molekulargewicht: 213kDa
NCBI: 23067
UniProt: Q9UPS6
Reinheit: Affinity purification
Sequenz: SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRAS
Target-Kategorie: SETD1B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Western blot analysis of various lysates using SETD1B Rabbit pAb (A20155) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.