SETD1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20155
Article Name: SETD1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20155
Supplier Catalog Number: A20155
Alternative Catalog Number: ABB-A20155-20UL,ABB-A20155-100UL,ABB-A20155-500UL,ABB-A20155-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KMT2G, Set1B, IDDSELD, SETD1B
SET1B is a component of a histone methyltransferase complex that produces trimethylated histone H3 at Lys4 (Lee et al., 2007 [PubMed 17355966]).
Clonality: Polyclonal
Molecular Weight: 213kDa
NCBI: 23067
UniProt: Q9UPS6
Purity: Affinity purification
Sequence: SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRAS
Target: SETD1B
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Western blot analysis of various lysates using SETD1B Rabbit pAb (A20155) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.