Stella Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20176
- Bilder (1)
| Artikelname: | Stella Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20176 |
| Hersteller Artikelnummer: | A20176 |
| Alternativnummer: | ABB-A20176-100UL,ABB-A20176-20UL,ABB-A20176-500UL,ABB-A20176-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PCG7, PGC7, Stella, 2410075G02Rik |
| Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation, protection of DNA demethylation of female pronucleus, and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm, female pronucleus, and male pronucleus. Is expressed in several structures, including central nervous system, early conceptus, gonad, hindgut diverticulum, and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 18kDa |
| NCBI: | 73708 |
| UniProt: | Q8QZY3 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN |
| Target-Kategorie: | Dppa3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Stella Rabbit pAb (A20176) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
