Stella Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20176
- Images (1)
| Article Name: | Stella Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20176 |
| Supplier Catalog Number: | A20176 |
| Alternative Catalog Number: | ABB-A20176-100UL,ABB-A20176-20UL,ABB-A20176-500UL,ABB-A20176-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PCG7, PGC7, Stella, 2410075G02Rik |
| Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation, protection of DNA demethylation of female pronucleus, and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm, female pronucleus, and male pronucleus. Is expressed in several structures, including central nervous system, early conceptus, gonad, hindgut diverticulum, and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3). |
| Clonality: | Polyclonal |
| Molecular Weight: | 18kDa |
| NCBI: | 73708 |
| UniProt: | Q8QZY3 |
| Purity: | Affinity purification |
| Sequence: | MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN |
| Target: | Dppa3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Stella Rabbit pAb (A20176) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Product Guarantee and Expert Support
