Btbd11 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20192
Artikelname: Btbd11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20192
Hersteller Artikelnummer: A20192
Alternativnummer: ABB-A20192-100UL,ABB-A20192-20UL,ABB-A20192-1000UL,ABB-A20192-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Btbd11, 6330404E16Rik
Predicted to enable protein heterodimerization activity. Acts upstream of or within SMAD protein signal transduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in central nervous system, dorsal root ganglion, genitourinary system, and thymus primordium. Orthologous to human BTBD11 (BTB domain containing 11).
Klonalität: Polyclonal
Molekulargewicht: 122kDa
NCBI: 74007
UniProt: Q6GQW0
Reinheit: Affinity purification
Sequenz: MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAV
Target-Kategorie: Abtb3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using Btbd11 Rabbit pAb (A20192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.