Btbd11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20192
Article Name: Btbd11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20192
Supplier Catalog Number: A20192
Alternative Catalog Number: ABB-A20192-100UL,ABB-A20192-20UL,ABB-A20192-1000UL,ABB-A20192-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Btbd11, 6330404E16Rik
Predicted to enable protein heterodimerization activity. Acts upstream of or within SMAD protein signal transduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in central nervous system, dorsal root ganglion, genitourinary system, and thymus primordium. Orthologous to human BTBD11 (BTB domain containing 11).
Clonality: Polyclonal
Molecular Weight: 122kDa
NCBI: 74007
UniProt: Q6GQW0
Purity: Affinity purification
Sequence: MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAV
Target: Abtb3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using Btbd11 Rabbit pAb (A20192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.