Tspan18 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20275
Artikelname: Tspan18 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20275
Hersteller Artikelnummer: A20275
Alternativnummer: ABB-A20275-20UL,ABB-A20275-100UL,ABB-A20275-1000UL,ABB-A20275-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 6720430O15, 2610042G18Rik, Tspan18
Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, brain, genitourinary system, immune system, and integumental system. Orthologous to human TSPAN18 (tetraspanin 18).
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 241556
UniProt: Q80WR1
Reinheit: Affinity purification
Sequenz: GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ
Target-Kategorie: Tspan18
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using Tspan18 Rabbit pAb (A20275) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.