Tspan18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20275
Article Name: Tspan18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20275
Supplier Catalog Number: A20275
Alternative Catalog Number: ABB-A20275-20UL,ABB-A20275-100UL,ABB-A20275-1000UL,ABB-A20275-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 6720430O15, 2610042G18Rik, Tspan18
Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, brain, genitourinary system, immune system, and integumental system. Orthologous to human TSPAN18 (tetraspanin 18).
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 241556
UniProt: Q80WR1
Purity: Affinity purification
Sequence: GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ
Target: Tspan18
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using Tspan18 Rabbit pAb (A20275) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.