Rev-erb beta/NR1D2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20447
Artikelname: Rev-erb beta/NR1D2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20447
Hersteller Artikelnummer: A20447
Alternativnummer: ABB-A20447-100UL,ABB-A20447-20UL,ABB-A20447-1000UL,ABB-A20447-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RVR, BD73, EAR-1R, REVERBB, REVERBbeta, Rev-erb beta/NR1D2
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 9975
UniProt: Q14995
Reinheit: Affinity purification
Sequenz: ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
Target-Kategorie: NR1D2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using Rev-erb beta/NR1D2 Rabbit pAb (A20447) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.