Rev-erb beta/NR1D2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20447
Article Name: Rev-erb beta/NR1D2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20447
Supplier Catalog Number: A20447
Alternative Catalog Number: ABB-A20447-100UL,ABB-A20447-20UL,ABB-A20447-1000UL,ABB-A20447-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RVR, BD73, EAR-1R, REVERBB, REVERBbeta, Rev-erb beta/NR1D2
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 9975
UniProt: Q14995
Purity: Affinity purification
Sequence: ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
Target: NR1D2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using Rev-erb beta/NR1D2 Rabbit pAb (A20447) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.