Caspase-1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20470
Artikelname: Caspase-1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20470
Hersteller Artikelnummer: A20470
Alternativnummer: ABB-A20470-100UL,ABB-A20470-20UL,ABB-A20470-500UL,ABB-A20470-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ICE, Il1bc, CASP1
Enables cysteine-type endopeptidase activity. Involved in several processes, including positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of interleukin-1 beta production, and protein autoprocessing. Acts upstream of or within several processes, including membrane hyperpolarization, mitochondrial depolarization, and positive regulation of interleukin-1 alpha production. Located in extracellular region. Part of IPAF inflammasome complex. Is expressed in knee joint and metanephros. Orthologous to human CASP1 (caspase 1).
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 12362
UniProt: P29452
Reinheit: Affinity purification
Sequenz: KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
Target-Kategorie: Casp1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis, using CASP1 Rabbit pAb (A20470) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.