Caspase-1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20470
Article Name: Caspase-1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20470
Supplier Catalog Number: A20470
Alternative Catalog Number: ABB-A20470-100UL,ABB-A20470-20UL,ABB-A20470-500UL,ABB-A20470-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ICE, Il1bc, CASP1
Enables cysteine-type endopeptidase activity. Involved in several processes, including positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of interleukin-1 beta production, and protein autoprocessing. Acts upstream of or within several processes, including membrane hyperpolarization, mitochondrial depolarization, and positive regulation of interleukin-1 alpha production. Located in extracellular region. Part of IPAF inflammasome complex. Is expressed in knee joint and metanephros. Orthologous to human CASP1 (caspase 1).
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 12362
UniProt: P29452
Purity: Affinity purification
Sequence: KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
Target: Casp1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis, using CASP1 Rabbit pAb (A20470) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.