DTX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20499
- Bilder (1)
| Artikelname: | DTX1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20499 |
| Hersteller Artikelnummer: | A20499 |
| Alternativnummer: | ABB-A20499-20UL,ABB-A20499-100UL,ABB-A20499-1000UL,ABB-A20499-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | hDx-1, RNF140, DTX1 |
| Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function, however, it may play a role in basic helix-loop-helix transcription factor activity. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 67kDa |
| NCBI: | 1840 |
| UniProt: | Q86Y01 |
| Reinheit: | Affinity purification |
| Sequenz: | MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSW |
| Target-Kategorie: | DTX1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Daudi cells usingDTX1 Rabbit pAb (A20499) at1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
