DTX1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20499
- Images (1)
| Article Name: | DTX1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20499 |
| Supplier Catalog Number: | A20499 |
| Alternative Catalog Number: | ABB-A20499-20UL,ABB-A20499-100UL,ABB-A20499-1000UL,ABB-A20499-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | hDx-1, RNF140, DTX1 |
| Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function, however, it may play a role in basic helix-loop-helix transcription factor activity. |
| Clonality: | Polyclonal |
| Molecular Weight: | 67kDa |
| NCBI: | 1840 |
| UniProt: | Q86Y01 |
| Purity: | Affinity purification |
| Sequence: | MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSW |
| Target: | DTX1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Daudi cells usingDTX1 Rabbit pAb (A20499) at1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
