MYO1D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20523
- Bilder (1)
| Artikelname: | MYO1D Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20523 |
| Hersteller Artikelnummer: | A20523 |
| Alternativnummer: | ABB-A20523-20UL,ABB-A20523-100UL,ABB-A20523-500UL,ABB-A20523-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | myr4, PPP1R108, MYO1D |
| Enables protein domain specific binding activity. Predicted to be involved in actin filament organization, early endosome to recycling endosome transport, and vesicle transport along actin filament. Located in extracellular exosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 116kDa |
| NCBI: | 4642 |
| UniProt: | O94832 |
| Reinheit: | Affinity purification |
| Sequenz: | HINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDTTIHGKNTVIG |
| Target-Kategorie: | MYO1D |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MYO1D Rabbit pAb (A20523) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
