MYO1D Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20523
- Images (1)
| Article Name: | MYO1D Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20523 |
| Supplier Catalog Number: | A20523 |
| Alternative Catalog Number: | ABB-A20523-20UL,ABB-A20523-100UL,ABB-A20523-500UL,ABB-A20523-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | myr4, PPP1R108, MYO1D |
| Enables protein domain specific binding activity. Predicted to be involved in actin filament organization, early endosome to recycling endosome transport, and vesicle transport along actin filament. Located in extracellular exosome. |
| Clonality: | Polyclonal |
| Molecular Weight: | 116kDa |
| NCBI: | 4642 |
| UniProt: | O94832 |
| Purity: | Affinity purification |
| Sequence: | HINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDTTIHGKNTVIG |
| Target: | MYO1D |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MYO1D Rabbit pAb (A20523) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
