CD300LB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20533
- Bilder (1)
| Artikelname: | CD300LB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20533 |
| Hersteller Artikelnummer: | A20533 |
| Alternativnummer: | ABB-A20533-20UL,ABB-A20533-100UL,ABB-A20533-500UL,ABB-A20533-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLM7, CLM-7, IREM3, TREM5, CD300b, IREM-3, TREM-5, CMRF35-A2, CD300LB |
| CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 23kDa |
| NCBI: | 124599 |
| UniProt: | A8K4G0 |
| Reinheit: | Affinity purification |
| Sequenz: | MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT |
| Target-Kategorie: | CD300LB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CD300LB Rabbit pAb (A20533) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
