CD300LB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A20533
Article Name: CD300LB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A20533
Supplier Catalog Number: A20533
Alternative Catalog Number: ABB-A20533-20UL,ABB-A20533-100UL,ABB-A20533-500UL,ABB-A20533-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CLM7, CLM-7, IREM3, TREM5, CD300b, IREM-3, TREM-5, CMRF35-A2, CD300LB
CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 124599
UniProt: A8K4G0
Purity: Affinity purification
Sequence: MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT
Target: CD300LB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using CD300LB Rabbit pAb (A20533) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.