FAM98B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20534
- Bilder (1)
| Artikelname: | FAM98B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20534 |
| Hersteller Artikelnummer: | A20534 |
| Alternativnummer: | ABB-A20534-20UL,ABB-A20534-100UL,ABB-A20534-1000UL,ABB-A20534-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM98B |
| Enables identical protein binding activity and protein methyltransferase activity. Involved in positive regulation of cell population proliferation, positive regulation of gene expression, and protein methylation. Located in cytoplasm and nucleoplasm. Part of tRNA-splicing ligase complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 46kDa |
| NCBI: | 283742 |
| UniProt: | Q52LJ0 |
| Reinheit: | Affinity purification |
| Sequenz: | MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRML |
| Target-Kategorie: | FAM98B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Other Antibodies Other Antibodies. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FAM98B Rabbit pAb (A20534) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
