FAM98B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A20534
- Images (1)
| Article Name: | FAM98B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A20534 |
| Supplier Catalog Number: | A20534 |
| Alternative Catalog Number: | ABB-A20534-20UL,ABB-A20534-100UL,ABB-A20534-1000UL,ABB-A20534-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM98B |
| Enables identical protein binding activity and protein methyltransferase activity. Involved in positive regulation of cell population proliferation, positive regulation of gene expression, and protein methylation. Located in cytoplasm and nucleoplasm. Part of tRNA-splicing ligase complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 46kDa |
| NCBI: | 283742 |
| UniProt: | Q52LJ0 |
| Purity: | Affinity purification |
| Sequence: | MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRML |
| Target: | FAM98B |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Other Antibodies Other Antibodies. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FAM98B Rabbit pAb (A20534) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
